PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco018061.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family ARF
Protein Properties Length: 784aa    MW: 86374.3 Da    PI: 6.5795
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco018061.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.13.5e-23156257199
                  EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                  f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g  W++++iyr++++r++lt+GW++Fv+ ++L +gD v+F   + +++ l
  Aco018061.1 156 FCKTLTASDTSTHGGFSVPRRAAEDCfpqldyKLQRP-SQELIAKDLHGVDWRFRHIYRGQPRRHLLTTGWSSFVNRKKLVSGDAVLFI--RGEDGVL 250
                  99****************************9977654.569************************************************..4489999 PP

                  EEEEE-S CS
           B3  93 vvkvfrk 99 
                  +++++r+
  Aco018061.1 251 RLGIRRA 257
                  9999986 PP

2Auxin_resp120.11.7e-39282363182
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                  +a+a+stks F+++YnPras+seF+v+++k++k++++ +svGmRfk ++e+eds+err++G+v+g+ d+dp+rWp+SkWr+L
  Aco018061.1 282 VANAVSTKSGFHIYYNPRASSSEFIVPYWKFMKSFSHAFSVGMRFKTRYESEDSAERRCTGLVTGIGDMDPLRWPGSKWRCL 363
                  689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.8E-38147259IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.22E-42149267IPR015300DNA-binding pseudobarrel domain
CDDcd100178.09E-20154256No hitNo description
PROSITE profilePS5086312.957156258IPR003340B3 DNA binding domain
SMARTSM010194.6E-22156258IPR003340B3 DNA binding domain
PfamPF023622.2E-21156257IPR003340B3 DNA binding domain
PfamPF065073.7E-34282363IPR010525Auxin response factor
PROSITE profilePS5174520.353674756IPR000270PB1 domain
SuperFamilySSF542771.96E-9682750No hitNo description
PfamPF023095.2E-5721764IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    Send to blast
MGIDLNTVEE EEDDEAAEPE HGGGAPIAAP QAAAAAEGGF PAGSVCLELW HACAGRSIAL  60
PRKGSVVVYL PQGHLEHFGG GGGGIGRCNV PPHVFCRVID VKLHADPATD EVYAQLSLVA  120
ESEEFGQQLL EGGMIDVECE NDEAEKERCS STRHMFCKTL TASDTSTHGG FSVPRRAAED  180
CFPQLDYKLQ RPSQELIAKD LHGVDWRFRH IYRGQPRRHL LTTGWSSFVN RKKLVSGDAV  240
LFIRGEDGVL RLGIRRAAQL RNGSPFVALY SQNSVLSTLT TVANAVSTKS GFHIYYNPRA  300
SSSEFIVPYW KFMKSFSHAF SVGMRFKTRY ESEDSAERRC TGLVTGIGDM DPLRWPGSKW  360
RCLLVRWDDK VDCSRQNRVS PWEIEPIGSV SGSHSLSASS SKRIKICLPT INPDFPVPNG  420
VDSTEPGEYA RFHKVLQGQE FMGFKARNAV SLSSSQLNME RCSTDRSGCS LASLRSAFGV  480
PVANSNFTRQ CAGFGESIRF DKVLQGQEFP SLPPFKGGSV DAYSRNGGFD AFNGEYASGT  540
NRWSGPVHVY ASFAQPSTPP SQASSPSSVL MFKQANYRIP HHQIVHRGAK DKDVSQLDSL  600
NPSGTFRGLS LLIDEHFEMG KVQDTVNVAR PLNNKKIDTN DCKLFGFSLS KRTPVTVETE  660
FATSKEHMLK SPRRGFTTVC KQGSIVDRVI DLSKFDGYDD LISELERLFN MEGMLSDPNN  720
KWHVVYTDDE DEMMLVGDDP WQEFCSIASK LLICTGDEGN MVACRVKVPE IGQMNYLLPS  780
MST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_B1e-110273931361Auxin response factor 1
4ldy_A1e-110273931361Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008798267.10.0PREDICTED: auxin response factor 15-like isoform X2
SwissprotQ0JKI90.0ARFB_ORYSJ; Auxin response factor 2
TrEMBLI1NQJ00.0I1NQJ0_ORYGL; Auxin response factor
STRINGORGLA01G0213000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25373580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.11e-180auxin response factor 4